CD99 Monoclonal antibody proteintech 60354-1-Ig
$449.00
In stock
SKU
60354-1-Ig
| Host / Isotype: Mouse / IgG1 | Class: Monoclonal |
| Reactivity: human | Immunogen: CatNo: Ag19474 Product name: Recombinant human CD99 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 28-115 aa of BC021620 Sequence: LSDALPDNENKKPTAIPKKPSAGDDFDLGDAVVDGENDDPRPPNPPKPMPNPNPNHPSSSGSFSDADLADGVSGGEGKGGSDGGGSHR Predict reactive species |
| Applications: WB, ELISA | Observed Molecular Weight: 19 kDa, 16 kDa, 17 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC021620 |
| Conjugate: Unconjugated | Gene Symbol: CD99 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 4267 |
| Application: Western Blot (WB) | RRID: AB_2881463 |
| Dilution: WB : 1:1000-1:4000 | Conjugate: Unconjugated |
| Tested Reactivity: Human | Form: Liquid |
| Host / Isotype: Mouse / IgG1 | Background Information: CD99, also known as MIC2, is a heavily O-glycosylated transmembrane protein involved in T-cell adhesion processes and in spontaneous rosette formation with erythrocytes. CD99 is broadly distributed on many cell types, with particularly strong expression on human cortical thymocytes, Ewing’s sarcoma cells and peripheral primitive neuroectodermal tumors (PMID: 9794396; 16984917). In normal cells, CD99 has been functionally implicated in cell adhesion, migration, apoptosis, differentiation, activation, and proliferation of lymphocytes and monocyte extravasation and transport of several transmembrane proteins (PMID: 16984917). CD99 displays two surface isoforms generated by alternative splicing: a long 32 kDa and a short 28 kDa form (PMID: 12368226). |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
