Apolipoprotein A II/APOA2 Monoclonal antibody proteintech 66773-1-Ig
$449.00
In stock
SKU
66773-1-Ig
| Host / Isotype: Mouse / IgG2b | Class: Monoclonal |
| Reactivity: human | Immunogen: CatNo: Ag9863 Product name: Recombinant human APOA2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-100 aa of BC005282 Sequence: MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAEAKSYFEKSKEQLTPLIKKAGTELVNFLSYFVELGTQPATQ Predict reactive species |
| Applications: WB, IHC, ELISA | Observed Molecular Weight: 100 aa, 11 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC005282 |
| Conjugate: Unconjugated | Gene Symbol: APOA2 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 336 |
| Application: Western Blot (WB) | RRID: AB_2882119 |
| Dilution: WB : 1:500-1:3000 | Conjugate: Unconjugated |
| Tested Reactivity: Human | Form: Liquid |
| Host / Isotype: Mouse / IgG2b | Background Information: Apolipoprotein A-II (APOA2) is a major component of high density lipoprotein (HDL) and it plays an important role in directing the fate of lipid metabolism among HDL. It is primarily synthesized by liver. The predicted MW of ApoA2 is 11 kDa, while the mature form is smaller (7-10 kDa) since the signal peptide was cleaved. In humans, most of circulating apoA2 exist as dimer. Five types of APOA2 dimer exist: homodimer apoA2-ATQ/ATQ, heterodimer apoA2-ATQ/AT, homodimer apoA2-AT/AT, apoA2-AT/A, and apoA2-A/A. ApoA2 isoforms are considered to be some of the most promising serum/plasma biomarkers for aiding the early detection of pancreatic cancer. (PMID: 29081441, 29481802) |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
