G6PC Polyclonal antibody proteintech 22169-1-AP
$449.00
In stock
SKU
22169-1-AP
G6PC1, EC:3.1.3.9, G6Pase, G-6-Pase, G6Pase-alpha
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human, Mouse And More (1) | Immunogen: CatNo: Ag17839 Product name: Recombinant human G6PC protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-60 aa of BC130478 Sequence: MEEGMNVLHDFGIQSTHYLQVNYQDSQDWFILVSVIADLRNAFYVLFPIWFHLQEAVGIK Predict reactive species |
| Applications: IHC, IF-P, ELISA | Observed Molecular Weight: 357 aa, 40 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: G6PC |
| Conjugate: Unconjugated | Gene Symbol: 2538 |
| Tested Applications: Positive IHC detected in | Gene ID (NCBI): AB_2879015 |
| Application: Immunohistochemistry (IHC) | RRID: Unconjugated |
| Dilution: IHC : 1:50-1:500 | Conjugate: Liquid |
| Tested Reactivity: Human, Mouse | Form: Antigen affinity purification |
| Host / Isotype: Rabbit / IgG | Background Information: Glucose-6-phosphatase-α (G6PC) is a key enzyme in glucose homeostasis that catalyzes the hydrolysis of glucose-6-phosphate to glucose and phosphate in the terminal step of gluconeogenesis and glycogenolysis. G6PC activity is restricted to the liver , the kidney cortex and the small intestine and confers on these three organs the capacity to release glucose into the systemic circulation (PMID: 21983240).The encoded enzyme is anchored to the ER by nine transmembrane helices with the amino (N)-terminus in the lumen and the carboxyl (C)-terminus in the cytoplasm (PMID: 15542400). |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
