N-cadherin Polyclonal antibody proteintech 22018-1-AP
$449.00
In stock
SKU
22018-1-AP
Cadherin 2, Cadherin-2, CD325, CDH2, CDHN
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human, Mouse, Rat And More (5) | Immunogen: CatNo: Ag16792 Product name: Recombinant human N-cadherin protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 421-535 aa of BC036470 Sequence: RISGGDPTGRFAIQTDQNSNDGLVTVVKPIDFEANRMFVLTVAAENQVPLAKGIQHPPQSTATMSVTVIDVNENPYFAPNPKIIRQEEGLHAGTMLTTFTAQDPDRYMQQNIRYT Predict reactive species |
| Applications: WB, IHC, IF/ICC, IF-P, IF-Fro, IP, CoIP, ELISA | Observed Molecular Weight: 906 aa, 100 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC036470 |
| Conjugate: Unconjugated | Gene Symbol: N-cadherin |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 1000 |
| Application: Western Blot (WB) | RRID: AB_2813891 |
| Dilution: WB : 1:2000-1:16000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Rabbit / IgG |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
