SPTLC1 Monoclonal antibody proteintech 66899-1-Ig
$449.00
In stock
SKU
66899-1-Ig
| Host / Isotype: Mouse / IgG1 | Class: Monoclonal |
| Reactivity: human, mouse, rat | Immunogen: CatNo: Ag7876 Product name: Recombinant human SPTLC1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-143 aa of BC007085 Sequence: MATATEQWVLVEMVQALYEAPAYHLILEGILILWIIRLLFSKTYKLQERSDLTVKEKEELIEEWQPEPLVPPVPKDHPALNYNIVSGPPSHKTVVNGKECINFASFNFLGLLDNPRVKAAALASLKKYGVGTCGPRGFYGTFE Predict reactive species |
| Applications: WB, IHC, IF/ICC, ELISA | Observed Molecular Weight: 53 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC007085 |
| Conjugate: Unconjugated | Gene Symbol: SPTLC1 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 10558 |
| Application: Western Blot (WB) | RRID: AB_2882228 |
| Dilution: WB : 1:5000-1:50000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Mouse / IgG1 | Background Information: SPTLC1 is a subunit of serine palmitoyltransferase (SPT) which is the key enzyme in sphingolipid biosynthesis and is essential for embryogenesis and cell survival. Mutations in the SPTLC1 gene (C133W, C133Y, V144D, and G387A) were reported to be responsible for the development of an inherited sensory neuropathy (hereditary sensory neuropathy type I, HSN1). |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
