NFIX Monoclonal antibody proteintech 67983-1-Ig
$449.00
In stock
SKU
67983-1-Ig
CTF, NF I/X, NF1 X, NF1A, NFI X, NFIX, Nuclear factor 1 X type, Nuclear factor 1/X, Nuclear factor I/X, TGGCA binding protein
| Host / Isotype: Mouse / IgG2b | Class: Monoclonal |
| Reactivity: Human, Mouse, Rat, Pig, Rabbit And More (1) | Immunogen: CatNo: Ag31447 Product name: Recombinant human NFIX protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 246-400 aa of NM_001271043 Sequence: ADLESPSYYNINQVTLGRRSITSPPSTSTTKRPKSIDDSEMESPVDDVFYPGTGRSPAAGSSQSSGWPNDVDAGPASLKKSGKLDFCSALSSQGSSPRMAFTHHPLPVLAGVRPGSPRATASALHFPSTSIIQQSSPYFTHPTIRYHHHHGQDSL Predict reactive species |
| Applications: WB, IHC, ELISA | Observed Molecular Weight: 50 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: NM_001271043 |
| Conjugate: Unconjugated | Gene Symbol: NFIX |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 4784 |
| Application: Western Blot (WB) | RRID: AB_2918732 |
| Dilution: WB : 1:2000-1:10000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat, Pig, Rabbit | Form: Liquid |
| Host / Isotype: Mouse / IgG2b | Background Information: NFIX, also named CTF, belongs to the CTF/NF-I family. NFIX recognizes and binds the palindromic sequence 5'-TTGGCNNNNNGCCAA-3' present in viral and cellular promoters and in the origin of replication of adenovirus type 2. NFIX is individually capable of activating transcription and replication. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
