IFITM3 Polyclonal antibody proteintech 11714-1-AP
$449.00
In stock
SKU
11714-1-AP
IP15, Interferon-inducible protein 1-8U, Interferon-induced transmembrane protein 3, IFITM2/3, DSPA2b
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human And More (7) | Immunogen: CatNo: Ag2285 Product name: Recombinant human IFITM3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-133 aa of BC006794 Sequence: MNHTVQTFFSPVNSGQPPNYEMLKEEHEVAVLGAPHNPAPPTSTVIHIRSETSVPDHVVWSLFNTLFMNPCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTILLIVIPVLIFQAYG Predict reactive species |
| Applications: WB, IHC, IF/ICC, IP, CoIP, ELISA | Observed Molecular Weight: 133 aa, 15 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC006794 |
| Conjugate: Unconjugated | Gene Symbol: IFITM3 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 10410 |
| Application: Western Blot (WB) | RRID: AB_2295684 |
| Dilution: WB : 1:5000-1:50000 | Conjugate: Unconjugated |
| Tested Reactivity: Human | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: IFITM3, also named as interferon-inducible protein 1-8U, belongs to the CD225 family. It is IFN-induced antiviral protein that mediates cellular innate immunity to at least three major human pathogens, namely influenza A H1N1 virus, West Nile virus (WNV), and dengue virus, by inhibiting the early steps of replication. IFITM3 is identified as interferon-induced cellular proteins that restrict infections by retroviruses and filoviruses and of influenza virus and flaviviruses, respectively. IFITM3, the most potent antiviral IFITM, was found to inhibit an uncharacterized early infectious event after VSV endocytosis, but before primary transcription of its viral genome. IFITM proteins are viral restriction factors that can inhibit infection mediated by the influenza A virus (IAV) hemagglutinin (HA) protein. They differentially restrict the entry of a broad range of enveloped viruses, and modulate cellular tropism independently of viral receptor expression. Catalog#11714-1-AP is a rabbit polyclonal antibody raised against the full-length of human IFITM3. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
