CDKN2A/P16-INK4A Polyclonal antibody proteintech 10883-1-AP
$449.00
In stock
SKU
10883-1-AP
p16, p16 INK4, P16 INK4A, p16-INK4, p16INK4A
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human And More (5) | Immunogen: CatNo: Ag1328 Product name: Recombinant human P16-INK4A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 52-156 aa of BC021998 Sequence: MMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD Predict reactive species |
| Applications: WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA | Observed Molecular Weight: 16 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC021998 |
| Conjugate: Unconjugated | Gene Symbol: CDKN2A |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 1029 |
| Application: Western Blot (WB) | RRID: AB_2078303 |
| Dilution: WB : 1:1000-1:6000 | Conjugate: Unconjugated |
| Tested Reactivity: Human | Form: Liquid |
| Host / Isotype: Rabbit / IgG |
Reviews
Write Your Own Review