ERAP2 Monoclonal antibody proteintech 67477-1-Ig
$449.00
In stock
SKU
67477-1-Ig
ERAP2, FLJ23633, FLJ23701, FLJ23807, L RAP, LRAP
| Host / Isotype: Mouse / IgG2b | Class: Monoclonal |
| Reactivity: Human, Rat And More (1) | Immunogen: CatNo: Ag30061 Product name: Recombinant human ERAP2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 41-180 aa of BC065240 Sequence: PSSYHFTEDPGAFPVATNGERFPWQELRLPSVVIPLHYDLFVHPNLTSLDFVASEKIEVLVSNATQFIILHSKDLEITNATLQSEEDSRYMKPGKELKVLSYPAHEQIALLVPEKLTPHLKYYVAMDFQAKLGDGFEGFY Predict reactive species |
| Applications: WB, ELISA | Observed Molecular Weight: 110 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC065240 |
| Conjugate: Unconjugated | Gene Symbol: ERAP2 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 64167 |
| Application: Western Blot (WB) | RRID: AB_2882704 |
| Dilution: WB : 1:1000-1:5000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Rat | Form: Liquid |
| Host / Isotype: Mouse / IgG2b | Background Information: ERAP2(Endoplasmic reticulum aminopeptidase 2) is also named as LRAP(Leukocyte-derived arginine aminopeptidase). It plays a central role in peptide trimming, a step required for the generation of most HLA class I-binding peptides. ERAP2 can form heterodimers with ERAP1(PMID:15908954). Defects in the expression of ERAP2 may cause improper antigen processing, possibly leading to favor tumor escape from the immune surveillance. ERAP2 has the calculated molecular mass of 105-110 kDa, and apparent molecular mass of 120 kDa duo to the glycosylation. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
