CAPN3 Monoclonal antibody proteintech 67366-1-Ig
$449.00
In stock
SKU
67366-1-Ig
1G12A5, Calcium-activated neutral proteinase 3, Calpain 3, calpain 3, (p94), Calpain L3
| Host / Isotype: Mouse / IgG1 | Class: Monoclonal |
| Reactivity: human, mouse, rat, pig | Immunogen: CatNo: Ag13179 Product name: Recombinant human CAPN3 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-156 aa of BC004883 Sequence: MEICADELKKVLNTVVNKHKDLKTHGFTLESCRSMIALMDTDGSGKLNLQEFHHLWNKIKAWQKIFKHYDTDQSGTINSYEMRNAVNDAGFHLNNQLYDIITMRYADKHMNIDFDSFICCFVRLEGMFRAFHAFDKDGDGIIKLNVLEWLQLTMYA Predict reactive species |
| Applications: WB, IHC, IF/ICC, IP, ELISA | Observed Molecular Weight: 18 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC004883 |
| Conjugate: Unconjugated | Gene Symbol: CAPN3 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 825 |
| Application: Western Blot (WB) | RRID: AB_2882618 |
| Dilution: WB : 1:1000-1:6000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat, Pig | Form: Liquid |
| Host / Isotype: Mouse / IgG1 | Background Information: Calpain 3 (CAPN3), a major intracellular protease, is a muscle-specific member of the calpain large subunit family that specifically binds to titin. CAPN3 plays a role in the dysferlin protein complex and that disruption of CAPN3 function may affect muscle membrane repair and remodeling. CAPN3 has some isoforms with MW of 94, 84, 93, 36, 18 kDa. CAPN3 autolysis generates a small N-terminal fragment of 34 kDa and a large C-terminal fragment whose size ranges from 55 to 60 kDa during self-processing (PMID: 9794799, 14645524). |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
