Calponin 1 Monoclonal antibody proteintech 66540-1-Ig
$449.00
In stock
SKU
66540-1-Ig
Calponin, CNN1, 1A11E5, Basic calponin, Calponin-1
| Host / Isotype: Mouse / IgG2b | Class: Monoclonal |
| Reactivity: Human And More (2) | Immunogen: CatNo: Ag21384 Product name: Recombinant human Calponin protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 225-265 aa of BC022015 Sequence: KRQIFEPGLGMEHCDTLNVSLQMGSNKGASQRGMTVYGLPR Predict reactive species |
| Applications: WB, IHC, IF, ELISA | Observed Molecular Weight: 33 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC022015 |
| Conjugate: Unconjugated | Gene Symbol: Calponin |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 1264 |
| Application: Western Blot (WB) | RRID: AB_2881902 |
| Dilution: WB : 1:1500-1:6000 | Conjugate: Unconjugated |
| Tested Reactivity: Human | Form: Liquid |
| Host / Isotype: Mouse / IgG2b | Background Information: Calponin is a family of actin filament-associated proteins which regulate smooth muscle cell contraction. Three isoforms of calponin exist: calponin h1 (CNN1) , calponin h2 (CNN2) and calponin 3 (CNN3). CNN1 is a basic 34-kD protein specifically expressed in smooth muscle and a marker of smooth muscle cell differentiation. This antibody raised against the specific region of human CNN1, thus it does not cross-react with CNN2 or CNN3. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
