ATP6 Monoclonal antibody proteintech 68442-1-Ig
$449.00
In stock
SKU
68442-1-Ig
ATP synthase subunit a, ATP6, ATPASE6, F ATPase protein 6, MT ATP6, MTATP6
| Host / Isotype: Mouse / IgG1 | Class: Monoclonal |
| Reactivity: Human, Rat And More (2) | Immunogen: CatNo: Ag31940 Product name: Recombinant human ATP6 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 26-68 aa of YP_003024031 Sequence: FPPLLIPTSKYLINNRLITTQQWLIKLTSKQMMTMHNTKGRTW Predict reactive species |
| Applications: WB, ELISA | Observed Molecular Weight: 25 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: YP_003024031 |
| Conjugate: Unconjugated | Gene Symbol: ATP6 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 4508 |
| Application: Western Blot (WB) | RRID: AB_3085155 |
| Dilution: WB : 1:5000-1:50000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Rat | Form: Liquid |
| Host / Isotype: Mouse / IgG1 | Background Information: ATP synthase, also known as FoF1 complex, is a critical mitochondrial OXPHOS enzyme involved in the regulation of mitochondrial ATP production and in the maintenance of the mitochondrial membrane potential. It is composed of three components (F1, Fo and the peripheral stalk). F1, the soluble catalytic core, is above the membrane, inside the matrix of the mitochondria; consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon); Fo, comprising the proton channel, is within the membrane; Fo seems to have nine subunits (a, b, c, d, e, f, g, F6 and 8). ATP6 is the a subunit of Fo region. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
