AGTR1 Monoclonal antibody proteintech 66415-1-Ig
$449.00
In stock
SKU
66415-1-Ig
Angiotensin II type-1 receptor, Angiotensin II type 1 receptor, AGTR1B, AGTR1A, AG2S
| Host / Isotype: Mouse / IgG2a | Class: Monoclonal |
| Reactivity: human, mouse, rat, pig | Immunogen: CatNo: Ag14461 Product name: Recombinant human AGTR1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 290-359 aa of BC022447 Sequence: IAYFNNCLNPLFYGFLGKKFKRYFLQLLKYIPPKAKSHSNLSTKMSTLSYRHSDNVSSSTKKPAPCFEVE Predict reactive species |
| Applications: WB, ELISA | Observed Molecular Weight: 359 aa, 41 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC022447 |
| Conjugate: Unconjugated | Gene Symbol: AGTR1 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 185 |
| Application: Western Blot (WB) | RRID: AB_2881787 |
| Dilution: WB : 1:1000-1:4000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat, Pig | Form: Liquid |
| Host / Isotype: Mouse / IgG2a | Background Information: Angiotensin II (Ang II), the main effector molecule of the renin-angiotensin system, exerts its actions mainly via interaction with type-1 angiotensin II receptor (AGTR1, also named as AT1R), thereby contributing to blood pressure regulation. AGTR1 mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. By regulating vascular tone, cardiovascular function, salt and water homeostasis, AGTR1 exerts an indispensable physiological role (PMID: 21600887). AGTR1 has been implicated in diverse aspects of human disease, from the regulation of blood pressure and cardiovascular homeostasis to cancer progression (PMID: 26975580). |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
