CD47 Monoclonal antibody proteintech 66304-1-Ig
$449.00
In stock
SKU
66304-1-Ig
Leukocyte surface antigen CD47, Integrin-associated protein, Integrin associated protein, IAP, CD47 molecule
| Host / Isotype: Mouse / IgG2b | Class: Monoclonal |
| Reactivity: Human And More (2) | Immunogen: CatNo: Ag14132 Product name: Recombinant human CD47 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-150 aa of BC010016 Sequence: MWPLVAALLLGSACCGSAQLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSPNENILIVIFPI Predict reactive species |
| Applications: WB, IF/ICC, ELISA | Observed Molecular Weight: 323 aa, 35 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC010016 |
| Conjugate: Unconjugated | Gene Symbol: CD47 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 961 |
| Application: Western Blot (WB) | RRID: AB_2881687 |
| Dilution: WB : 1:5000-1:50000 | Conjugate: Unconjugated |
| Tested Reactivity: Human | Form: Liquid |
| Host / Isotype: Mouse / IgG2b | Background Information: CD47, also known as integrin-associated protein (IAP), is a member of the immunoglobulin superfamily containing a five-pass transmembrane attachment. CD47 is heavily glycosylated and widely expressed by hematopoietic and nonhematopoietic cells. CD47 interacts with several membrane integrins and also acts a receptor for thrombospondin (THBS1). It is involved in a range of cellular processes, including apoptosis, proliferation, adhesion, and migration. CD47 also functions as a ligand for signal regulatory protein-α (SIRPα). Upon binding CD47, SIRPα initiates a signaling cascade that results in the inhibition of phagocytosis. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
