TSPO/PBR Monoclonal antibody proteintech 68137-1-Ig
$449.00
In stock
SKU
68137-1-Ig
TSPO, 1D1F12, BZRP, MBR, Peripheral-type benzodiazepine receptor
| Host / Isotype: Mouse / IgM | Class: Monoclonal |
| Reactivity: human, mouse, rat | Immunogen: CatNo: Ag7475 Product name: Recombinant human TSPO protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-169 aa of BC001110 Sequence: MAPPWVPAMGFTLAPSLGCFVGSRFVHGEGLRWYAGLQKPSWHPPHWVLGPVWGTLYSAMGYGSYLVWKELGGFTEKAVVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLLLVSGAAAATTVAWYQVSPLAARLLYPYLAWLAFATTLNYCVWRDNHGWHGGRRLPE Predict reactive species |
| Applications: WB, IF/ICC, ELISA | Observed Molecular Weight: 18 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC001110 |
| Conjugate: Unconjugated | Gene Symbol: TSPO |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 706 |
| Application: Western Blot (WB) | RRID: AB_2923664 |
| Dilution: WB : 1:2000-1:16000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Mouse / IgM | Background Information: TSPO, also named Peripheral-type benzodiazepine receptor (PBR), encodes the translocator protein, belonging to tryptophan-rich sensory protein family. The protein is mainly localized in the outer mitochondrial membrane and expressed in steroid-synthesizing tissues (PMID:32881658, PMID:1326278). TSPO is involved in the translocation of cholesterol from the outer to inner mitochondrial membrane (PMID:21119734). In response to injury, TSPO has a upregulated expression in the peripheral nervous system (PMID:32423330, PMID:23251719). TSPO is also as a biomarker in a non-invasive procedure including detecting the inflammation in the heart and atherosclerotic plaques (PMID:24402571). |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
