S100A10 Monoclonal antibody proteintech 66227-1-Ig
$449.00
In stock
SKU
66227-1-Ig
1B3F9, ANX2L, ANX2LG, CAL1L, Calpactin 1 light chain
| Host / Isotype: Mouse / IgG1 | Class: Monoclonal |
| Reactivity: Human And More (1) | Immunogen: CatNo: Ag23596 Product name: Recombinant human S100A10 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 1-97 aa of BC015973 Sequence: MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK Predict reactive species |
| Applications: WB, IHC, IF/ICC, ELISA | Observed Molecular Weight: 11 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC015973 |
| Conjugate: Unconjugated | Gene Symbol: S100A10 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 6281 |
| Application: Western Blot (WB) | RRID: AB_2881618 |
| Dilution: WB : 1:1000-1:4000 | Conjugate: Unconjugated |
| Tested Reactivity: Human | Form: Liquid |
| Host / Isotype: Mouse / IgG1 | Background Information: S100A10, also known as p11, is a member of the S100 family of small, EF hand containing dimeric proteins. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100A10 is present on the surface of endothelial and other cells in a heterotetrameric complex with another Ca(2+)-binding protein, annexin II. S100A10 may function in exocytosis and endocytosis. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
