Histone H3 Polyclonal antibody proteintech 17168-1-AP
$189.00
In stock
SKU
17168-1-AP
H3, HIST2H3A, H3C13, H3C14, H3C15
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human, Mouse, Rat And More (7) | Immunogen: CatNo: Ag10644 Product name: Recombinant human Histone-H3 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-136 aa of BC015544 Sequence: MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA Predict reactive species |
| Applications: WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ChIP, ELISA | Observed Molecular Weight: 136 aa, 15 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC015544 |
| Conjugate: Unconjugated | Gene Symbol: Histone H3 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 333932 |
| Application: Western Blot (WB) | RRID: AB_2716755 |
| Dilution: WB : 1:2000-1:16000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: Histone-H3, histone cluster 2, H3a is the core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machinery which requires DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. Histone-H3 is expressed during S phase; then expression strongly decreases as cell division slows down during the process of differentiation. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
