HOXA7 Monoclonal antibody proteintech 67112-1-Ig
$449.00
In stock
SKU
67112-1-Ig
2A7H6, ANTP, Homeobox protein Hox-1A, Homeobox protein Hox-A7, HOX1
| Host / Isotype: Mouse / IgG1 | Class: Monoclonal |
| Reactivity: Human And More (1) | Immunogen: CatNo: Ag19025 Product name: Recombinant human HOXA7 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-110 aa of BC148692 Sequence: MSSSYYVNALFSKYTAGASLFQNAEPTSCSFAPNSQRSGYGAGAGAFASTVPGLYNVNSPLYQSPFASGYGLGADAYGNLPCASYDQNIPGLCSDLAKGACDKTDEGALH Predict reactive species |
| Applications: WB, IHC, IF/ICC, ELISA | Observed Molecular Weight: 230 aa, 25 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC148692 |
| Conjugate: Unconjugated | Gene Symbol: HOXA7 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 3204 |
| Application: Western Blot (WB) | RRID: AB_2882416 |
| Dilution: WB : 1:2000-1:10000 | Conjugate: Unconjugated |
| Tested Reactivity: Human | Form: Liquid |
| Host / Isotype: Mouse / IgG1 | Background Information: HOX genes play a fundamental role in the development of the vertebrate central nervous system, heart, axial skeleton, limbs, gut, urogenital tract and external genitalia. The homeobox gene Hoxa-1 is transcriptionally regulated by retinoic acid (RA) and encodes a transcription factor, which has been shown to play important roles in cell differentiation and embryogenesis. Hoxa-1 is also expressed in cancers, such as mammary tumors, though it is not expressed in normal gland or in precancerous mammary tissues. At embryonic stages, Hoxa-2 is expressed in the mesenchyme and epithelial cells of palate, however its expression is restricted to the tips of the growing palatal shelves. Hoxa-2 protein is predominantly expressed in the nuclei of cells in the ventral mantle region of the developing embryo. In the developing and adult mouse spinal cord, Hoxa-2 protein may contribute to dorsal-ventral patterning and/or to the specification of neuronal phenotype. Hoxa-7 functions as a potent transcriptional repressor and its action as such requires several domains, including both activator and repressor regions. Hoxa-7 is expressed in the fetal liver, lung, skeletal muscle, kidney, pancreas and placenta. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
