G6PC Polyclonal antibody proteintech 25771-1-AP
$449.00
In stock
SKU
25771-1-AP
G6PC1, G6PT, G6Pase-alpha, G-6-Pase, G6Pase
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human, Rat And More (1) | Immunogen: CatNo: Ag22683 Product name: Recombinant human G6PC protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-62 aa of BC136369 Sequence: MEEGMNVLHDFGIQSTHYLQVNYQDSQDWFILVSVIADLRNAFYVLFPIWFHLQEAVGIKLL Predict reactive species |
| Applications: WB, ELISA | Observed Molecular Weight: 42 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: G6PC |
| Conjugate: Unconjugated | Gene Symbol: 2538 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): AB_3669498 |
| Application: Western Blot (WB) | RRID: Unconjugated |
| Dilution: WB : 1:1000-1:6000 | Conjugate: Liquid |
| Tested Reactivity: Human, Rat | Form: Antigen affinity purification |
| Host / Isotype: Rabbit / IgG | Background Information: Glucose-6-phosphatase-α (G6PC) is a key enzyme in glucose homeostasis that catalyzes the hydrolysis of glucose-6-phosphate to glucose and phosphate in the terminal step of gluconeogenesis and glycogenolysis. G6PC activity is restricted to the liver, the kidney cortex, and the small intestine and confers on these three organs the capacity to release glucose into the systemic circulation (PMID: 21983240). The encoded enzyme is anchored to the ER by nine transmembrane helices with the amino (N)-terminus in the lumen and the carboxyl (C)-terminus in the cytoplasm (PMID: 15542400). |
Reviews
Write Your Own Review