FABP2 Monoclonal antibody proteintech 67691-1-Ig
$449.00
In stock
SKU
67691-1-Ig
2D11G6, FABPI, Fatty acid binding protein 2, Fatty acid-binding protein 2, Fatty acid-binding protein, intestinal
| Host / Isotype: Mouse / IgG1 | Class: Monoclonal |
| Reactivity: human, mouse, rat, pig, rabbit | Immunogen: CatNo: Ag17620 Product name: Recombinant human FABP2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-132 aa of BC069617 Sequence: MAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEAKRIFKKD Predict reactive species |
| Applications: WB, IHC, IF-P, ELISA | Observed Molecular Weight: 132 aa, 15 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC069617 |
| Conjugate: Unconjugated | Gene Symbol: FABP2 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 2169 |
| Application: Western Blot (WB) | RRID: AB_2882884 |
| Dilution: WB : 1:2000-1:50000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat, Pig, Rabbit | Form: Liquid |
| Host / Isotype: Mouse / IgG1 | Background Information: FABP2, also known as the intestinal fatty acid binding protein (I-FABP), is expressed in the absorptive intestinal villus cells. It is mainly involved in intracellular transport and intestinal absorption of lipids. FABP2 has been considered a marker of mucosal injury and ischemia and serum I-FABP level is used as a tissue damage indicator. In addition, it is a marker of differentiated intestinal epithelial cells. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
