COMMD5 Monoclonal antibody proteintech 67043-1-Ig
$449.00
In stock
SKU
67043-1-Ig
COMM domain containing 5, COMMD5, FLJ13008, HCARG, HT002
| Host / Isotype: Mouse / IgG2a | Class: Monoclonal |
| Reactivity: Human, Rat And More (1) | Immunogen: CatNo: Ag18464 Product name: Recombinant human COMMD5 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 4-159 aa of BC003055 Sequence: VGAATPYLHHPGDSHSGRVSFLGAQLPPEVAAMARLLGDLDRSTFRKLLKFVVSSLQGEDCREAVQRLGVSANLPEEQLGALLAGMHTLLQQALRLPPTSLKPDTFRDQLQELCIPQDLVGDLASVVFGSQRPLLDSVAQQQGAWLPHVADFRWRV Predict reactive species |
| Applications: WB, ELISA | Observed Molecular Weight: 25 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC003055 |
| Conjugate: Unconjugated | Gene Symbol: COMMD5 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 28991 |
| Application: Western Blot (WB) | RRID: AB_2882357 |
| Dilution: WB : 1:2000-1:6000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Rat | Form: Liquid |
| Host / Isotype: Mouse / IgG2a | Background Information: COMM domain containing 5 (COMMD5, synonyms: HCARG, HT002) is a hypertension-related calcium-regulated gene. COMMD5 is negatively regulated by extracellular calcium concentration, and its basal mRNA levels were higher in hypertensive animals. Tissue distribution of COMMD5 shows a preponderance in the heart, stomach, jejunum, kidney (tubular fraction), liver, and adrenal gland (mainly in the medulla). COMMD5 mRNA is significantly more expressed in adult than in fetal organs, and its levels are decreased in tumors and cancerous cell lines. COMMD5 protein has no transmembrane domain, but contains 67% -helix content, a calcium-binding site, four putative "leucine zipper" motifs, and a nuclear receptor-binding domain. At the subcellular level, COMMD5 shows a nuclear localization. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
