Occludin Polyclonal antibody proteintech 27260-1-AP
$449.00
In stock
SKU
27260-1-AP
OCLN
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human, Mouse, Rat And More (7) | Immunogen: CatNo: Ag26173 Product name: Recombinant human Occludin protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 360-522 aa of BC029886 Sequence: VDDFRQPRYSSGGNFETPSKRAPAKGRAGRSKRTEQDHYETDYTTGGESCDELEEDWIREYPPITSDQQRQLYKRNFDTGLQEYKSLQSELDEINKELSRLDKELDDYREESEEYMAAADEYNRLKQVKGSADYKSKKNHCKQLKSKLSHIKKMVGDYDRQKT Predict reactive species |
| Applications: WB, IHC, IF/ICC, IF-Fro, IP, ELISA | Observed Molecular Weight: 522 aa, 59 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC029886 |
| Conjugate: Unconjugated | Gene Symbol: Occludin |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 4950 |
| Application: Western Blot (WB) | RRID: AB_2880820 |
| Dilution: WB : 1:5000-1:50000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: Occludin is an integral membrane protein located at the tight junction. It is a tetraspanin protein with four transmembrane domains, intracellular N and C termini, and two extracellular loops. Occludin plays a role in the formation and regulation of the tight junction paracellular permeability barrier. Occludin can exist in different isoforms, owing to modifications at the posttranscriptional and posttranslational levels, the monomeric occludin migrates as 53-65 kDa on SDS-PAGE (PMID: 22083955; 19457074). |