Profilin 1 Monoclonal antibody proteintech 67390-1-Ig
$449.00
In stock
SKU
67390-1-Ig
PFN1, 3A12E8, ALS18, PFN 1, Profilin I
| Host / Isotype: Mouse / IgG2b | Class: Monoclonal |
| Reactivity: human, mouse, rat | Immunogen: CatNo: Ag29206 Product name: Recombinant human PFN1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-140 aa of BC006768 Sequence: MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFYVNGLTLGGQKCSVIRDSLLQDGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKEGVHGGLINKKCYEMASHLRRSQY Predict reactive species |
| Applications: WB, IHC, IF/ICC, IP, ELISA | Observed Molecular Weight: 140 aa, 15 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC006768 |
| Conjugate: Unconjugated | Gene Symbol: Profilin 1 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 5216 |
| Application: Western Blot (WB) | RRID: AB_2882634 |
| Dilution: WB : 1:5000-1:50000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Mouse / IgG2b | Background Information: Profilin-1 (PFN1) plays an important role in the control of actin dynamics, and could represent an important therapeutic target in several diseases. PFN1 is identified as a huntingtin aggregation inhibitor, and may serves as a tumor-suppressor. PFN1 is crucial for the conversion of monomeric (G)-actin to filamentous (F)-actin. Amyotrophic lateral sclerosis (ALS) is a late-onset neurodegenerative disorder resulting from motor neuron death. Cells expressing PFN1 mutants contain ubiquitinated, insoluble aggregates that in many cases contain the ALS-associated protein TDP-43. Recently, PFN1 is a potential biomarker for bladder cancer aggressiveness and may be of great clinical importance. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
