NeuN Polyclonal antibody proteintech 26975-1-AP
$449.00
In stock
SKU
26975-1-AP
Fox-1 homolog C, FOX3, HRNBP3, NeuN antigen, Neuronal nuclei antigen
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human, Mouse, Rat, Pig And More (2) | Immunogen: CatNo: Ag25689 Product name: Recombinant human NeuN protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-100 aa of NM_001082575 Sequence: MAQPYPPAQYPPPPQNGIPAEYAPPPPHPTQDYSGQTPVPTEHGMTLYTPAQTHPEQPGSEASTQPIAGTQTVPQTDEAAQTDSQPLHPSDPTEKQQPKR Predict reactive species |
| Applications: WB, IHC, IF-P, IF-Fro, FC (Intra), Dot blot, ELISA | Observed Molecular Weight: 46-52 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: NeuN |
| Conjugate: Unconjugated | Gene Symbol: 146713 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): AB_2880708 |
| Application: Western Blot (WB) | RRID: Unconjugated |
| Dilution: WB : 1:20000-1:100000 | Conjugate: Liquid |
| Tested Reactivity: Human, Mouse, Rat, Pig | Form: Antigen affinity purification |
| Host / Isotype: Rabbit / IgG |
Reviews
Write Your Own Review