PGRMC2 Monoclonal antibody proteintech 60249-1-Ig
$449.00
In stock
SKU
60249-1-Ig
5F10D7, DG6, Membrane-associated progesterone receptor component 2, PMBP
| Host / Isotype: Mouse / IgG2a | Class: Monoclonal |
| Reactivity: Human, Pig And More (1) | Immunogen: CatNo: Ag20077 Product name: Recombinant human PGRMC2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 55-145 aa of BC016692 Sequence: LLNVALVALVLLGAYRLWVRWGRRGLGAGAGAGEESPATSLPRMKKRDFSLEQLRQYDGSRNPRILLAVNGKVFDVTKGSKFYGPAGPYGI Predict reactive species |
| Applications: WB, IHC, IF-P, FC (Intra), ELISA | Observed Molecular Weight: 223 aa, 24 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC016692 |
| Conjugate: Unconjugated | Gene Symbol: PGRMC2 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 10424 |
| Application: Western Blot (WB) | RRID: AB_2881370 |
| Dilution: WB : 1:2000-1:10000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Pig | Form: Liquid |
| Host / Isotype: Mouse / IgG2a | Background Information: Membrane-associated progesterone receptor component 2 (PGRMC2), also known as DG6 or PMBP, belongs to the cytochrome b5 family. This protein might play a role in cancer. The gene of PGRMC2 maps to chromosome 4q26, and encodes a 223-amino acid single-pass membrane protein with a cytochrome b5 heme-binding domain in its cytoplasmic domain. PGRMC2 has a calculated molecular weight of 24 kDa. The band of about 28 kDa detected by this monoclonal antibody is unknown but may represent phosphorylated form of PGRMC2 (PMID: 28104494). |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
