Thioredoxin Monoclonal antibody proteintech 66475-1-Ig
$449.00
In stock
SKU
66475-1-Ig
ADF, ATL derived factor, SASP, thioredoxin, TRDX, TRX, TRX1, TXN
| Host / Isotype: Mouse / IgG2a | Class: Monoclonal |
| Reactivity: Human And More (1) | Immunogen: CatNo: Ag6355 Product name: Recombinant human TXN protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-105 aa of BC003377 Sequence: MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV Predict reactive species |
| Applications: WB, IHC, IF/ICC, ELISA | Observed Molecular Weight: 12 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC003377 |
| Conjugate: Unconjugated | Gene Symbol: TXN |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 7295 |
| Application: Western Blot (WB) | RRID: AB_2881841 |
| Dilution: WB : 1:5000-1:50000 | Conjugate: Unconjugated |
| Tested Reactivity: Human | Form: Liquid |
| Host / Isotype: Mouse / IgG2a | Background Information: TXN, TRDX, TRX, TRX1, ADF and SASP, belongs to the thioredoxin family. It participates in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyzes dithiol-disulfide exchange reactions. TXN plays a role in the reversible S-nitrosylation of cysteine residues in target proteins, and thereby contributes to the response to intracellular nitric oxide. Nitrosylates the active site Cys of CASP3 in response to nitric oxide (NO), and thereby inhibits caspase-3 activity. TXN induces the FOS/JUN AP-1 DNA-binding activity in ionizing radiation (IR) cells through its oxidation/reduction status and stimulates AP-1 transcriptional activity. |
Reviews
Write Your Own Review