CCRL2 Monoclonal antibody proteintech 66611-1-Ig
$449.00
In stock
SKU
66611-1-Ig
C C chemokine receptor like 2, CCR11, CCR6, CCRL2, Chemokine receptor CCR11, Chemokine receptor X, CKRX, CRAM, CRAM A, CRAM B, HCR
| Host / Isotype: Mouse / IgG1 | Class: Monoclonal |
| Reactivity: Human And More (1) | Immunogen: CatNo: Ag4045 Product name: Recombinant human CCRL2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 250-344 aa of BC025717 Sequence: MWAPYNIAFFLSTFKEHFSLSDCKSSYNLDKSVHITKLIATTHCCINPLLYAFLDGTFSKYLCRCFHLRSNTPLQPRGQSAQGTSREEPDHSTEV Predict reactive species |
| Applications: WB, IHC, ELISA | Observed Molecular Weight: 344 aa, 40 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC025717 |
| Conjugate: Unconjugated | Gene Symbol: CCRL2 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 9034 |
| Application: Western Blot (WB) | RRID: AB_2881971 |
| Dilution: WB : 1:1000-1:6000 | Conjugate: Unconjugated |
| Tested Reactivity: Human | Form: Liquid |
| Host / Isotype: Mouse / IgG1 | Background Information: Chemokine CC motif receptor-like 2 (CCRL2) is a seven-transmembrane domain receptor that shares structural and functional similarities with the family of atypical chemokine receptors (ACKRs) (PMID: 28743719). CCRL2 does not appear to be a signaling receptor, but may have a role in modulating chemokine-triggered immune responses by capturing and internalizing CCL19 or by presenting RARRES2 ligand to CMKLR1, a functional signaling receptors. CCRL2 has been found on almost all hemopoietic cells, including monocytes, macrophages, polymorphonuclear neutrophils (PMNs), T cells, dendritic cells, natural killer cells, and CD34+ progenitor cells, with PMNs expressing the highest levels (PMID: 15188357). CCRL2 is also expressed by barrier cells, such as lymphatic and blood endothelial cells and bronchial and intestinal epithelial cells (PMID: 29056935). |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
