OCT4/POU5F1 Monoclonal antibody proteintech 60242-1-Ig
$449.00
In stock
SKU
60242-1-Ig
OCT4, POU5F1, 1C4B6, OCT3, Oct-3
| Host / Isotype: Mouse / IgG1 | Class: Monoclonal |
| Reactivity: human, mouse, rat | Immunogen: CatNo: Ag1794 Product name: Recombinant human OCT4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 102-265 aa of BC020712 Sequence: MCKLRPLLQKWVEEADNNENLQEICKAETLVQARKRKRTSIENRVRGNLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGKRSSSDYAQREDFEAAGSPFSGGPVSFPLAPGPHFGTPGYGSPHFTALYSSVPFPEGEAFPPVSVTTLGSPMHSN Predict reactive species |
| Applications: WB, ELISA | Observed Molecular Weight: 39 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC020712 |
| Conjugate: Unconjugated | Gene Symbol: POU5F1 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 5460 |
| Application: Western Blot (WB) | RRID: AB_2881364 |
| Dilution: WB : 1:5000-1:20000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Mouse / IgG1 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
