CCR6 Monoclonal antibody proteintech 66801-1-Ig
$449.00
In stock
SKU
66801-1-Ig
1C11A9, BN 1, C C chemokine receptor type 6, C C CKR 6, C-C chemokine receptor type 6
| Host / Isotype: Mouse / IgG2a | Class: Monoclonal |
| Reactivity: Human And More (1) | Immunogen: CatNo: Ag24195 Product name: Recombinant human CCR6 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-47 aa of BC037960 Sequence: MSGESMNFSDVFDSSEDYFVSVNTSYYSVDSEMLLCSLQEVRQFSRL Predict reactive species |
| Applications: WB, IHC, IF/ICC, IF-P, ELISA | Observed Molecular Weight: 42 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: CCR6 |
| Conjugate: Unconjugated | Gene Symbol: 1235 |
| Tested Applications: Positive IHC detected in | Gene ID (NCBI): AB_2882144 |
| Application: Immunohistochemistry (IHC) | RRID: Unconjugated |
| Dilution: IHC : 1:250-1:1000 | Conjugate: Liquid |
| Tested Reactivity: Human | Form: Protein A purification |
| Host / Isotype: Mouse / IgG2a | Background Information: CCR6, also known as CD196, is a C-C chemokine receptor that belongs to family A of G protein-coupled receptor superfamily. It is expressed in most B cells, memory T cells, and some subsets of dendritic cells (PMID: 17057190). CCR6 is a receptor for the C-C type chemokine CCL20 (PMID: 9169459). The ligand-receptor pair CCL20-CCR6 is responsible for the chemoattraction of immature dendritic cells, effector/memory T-cells, and B-cells and plays a role in skin and mucosal surfaces under homeostatic and inflammatory conditions, as well as in pathology, including cancer and rheumatoid arthritis (PMID: 12948524). CCR6 polymorphism has been associated with rheumatoid arthritis susceptibility and CCR6 is involved in IL-17-driven autoimmunity in human diseases (PMID: 20453841). |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
