MYL6 Monoclonal antibody proteintech 68142-1-Ig
$449.00
In stock
SKU
68142-1-Ig
17 kDa myosin light chain, ESMLC, LC17, LC17 GI, LC17 NM, LC17A, LC17B, MLC 3, MLC1SM, MLC3NM, MLC3SM, MYL6, Myosin light chain 3, Myosin light chain A3, Myosin light chain alkali 3, Myosin light polypeptide 6
| Host / Isotype: Mouse / IgG1 | Class: Monoclonal |
| Reactivity: Human, mouse, rat, pig, rabbit and More (1) | Immunogen: CatNo: Ag13091 Product name: Recombinant human MYL6 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-151 aa of BC006781 Sequence: MCDFTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDEMNVKVLDFEHFLPMLQTVAKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKMTEEEVEMLVAGHEDSNGCINYEAFVRHILSG Predict reactive species |
| Applications: WB, IHC, IF/ICC, ELISA | Observed Molecular Weight: 17 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC006781 |
| Conjugate: Unconjugated | Gene Symbol: MYL6 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 4637 |
| Application: Western Blot (WB) | RRID: AB_2935258 |
| Dilution: WB : 1:5000-1:50000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, mouse, rat, pig, rabbit | Form: Liquid |
| Host / Isotype: Mouse / IgG1 | Background Information: Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. MYL6 (Myosin light polypeptide 6), encodes a myosin alkali light chain that is expressed in smooth muscle and non-muscle tissues. Expression of MYL6 is high in fibroblasts and myoblasts (PMID:8188229, PubMed:2304459, PMID:2722814). |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
