FADS2 Monoclonal antibody proteintech 68026-1-Ig
$449.00
In stock
SKU
68026-1-Ig
EC:1.14.19.3, Delta-6 desaturase, D6D, Acyl-CoA 6-desaturase, 1G4B10
| Host / Isotype: Mouse / IgG2b | Class: Monoclonal |
| Reactivity: human, mouse, rat | Immunogen: CatNo: Ag27715 Product name: Recombinant human FADS2-Specific protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-124 aa of BC009011 Sequence: MGKGGNQGEGAAEREVSVPTFSWEEIQKHNLRTDRWLVIDRKVYNITKWSIQHPGGQRVIGHYAGEDATDAFRAFHPDLEFVGKFLKPLLIGELAPEEPSQDHGKNSKITEDFRALRKTAEDMN Predict reactive species |
| Applications: WB, IHC, IF/ICC, ELISA | Observed Molecular Weight: 445 aa, 49 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC009011 |
| Conjugate: Unconjugated | Gene Symbol: FADS2 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 9415 |
| Application: Western Blot (WB) | RRID: AB_2923633 |
| Dilution: WB : 1:5000-1:50000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Mouse / IgG2b | Background Information: Fatty acid desaturase 2 (FADS2) is responsible for the first desaturation reaction in the synthesis of highly unsaturated fatty acids (HUFAs), such as arachidonic acid (20:4n-6) and eicosapentaenoic acid (20:5n-3), and is involved in Mead acid (20:3n-9) production during essential fatty acid deficiency (EFAD) (PMID: 29353041). This is important when temperatures changes and the membrane is under distress. It has 4 isoforms produced by alternative splicing. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
