TWIST2 Monoclonal antibody proteintech 66544-1-Ig
$449.00
In stock
SKU
66544-1-Ig
bHLHa39, Dermis expressed protein 1, Dermo 1, DERMO1, twist homolog 2 (Drosophila), Twist related protein 2, TWIST2
| Host / Isotype: Mouse / IgG1 | Class: Monoclonal |
| Reactivity: Human, Rat, Mouse, Pig And More (1) | Immunogen: CatNo: Ag2348 Product name: Recombinant human TWIST2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-160 aa of BC033168 Sequence: MEEGSSSPVSPVDSLGTSEEELERQPKRFGRKRRYSKKSSEDGSPTPGKRGKKGSPSAQSFEELQSQRILANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDEMDNKMTSCSYVAHERLSYAFSVWRMEGAWSMSASH Predict reactive species |
| Applications: WB, IHC, IF/ICC, ELISA | Observed Molecular Weight: 160 aa, 18 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC033168 |
| Conjugate: Unconjugated | Gene Symbol: TWIST2 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 117581 |
| Application: Western Blot (WB) | RRID: AB_2881906 |
| Dilution: WB : 1:5000-1:20000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Rat, Mouse, Pig | Form: Liquid |
| Host / Isotype: Mouse / IgG1 | Background Information: TWIST2, also named as BHLHA39 and DERMO1,is a basic helix-loop-helix protein which acts as a transcriptional regulator, plays a central role in differentiation of mesodermal during embryogenesis. TWIST2 inhibits the premature or ectopic differentiation of preosteoblast cells during osteogenesis, possibly by changing the internal signal transduction response of osteoblasts to external growth factors. It is also implicated in tumorigenesis, invasion and metastasis. TWIST2 forms both homodimers(45KD) and heterodimers with E2A E proteins, and dimer partner selection is a critical mediator of TWIST function. (PMID:14724576, 16502419). |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
