Transgelin 2 Monoclonal antibody proteintech 60044-1-Ig
$449.00
In stock
SKU
60044-1-Ig
TAGLN2, 2E5G1, CDABP0035, Epididymis tissue protein Li 7e, SM22-alpha homolog
| Host / Isotype: Mouse / IgG1 | Class: Monoclonal |
| Reactivity: human, mouse | Immunogen: CatNo: Ag0337 Product name: Recombinant human TAGLN2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 4-130 aa of BC002616 Sequence: RGPAYGLSREVQQKIEKQYDADLEQILIQWITTQCRKDVGRPQPGRENFQNWLKDGTVLCELINAQYPEGQAPVKKIQASTMAFKQMEQISQFLQAAERYGINTTDIFQTVDLWEGKNMACVQRTLM Predict reactive species |
| Applications: WB, IHC, IF/ICC, IF-P, IP, CoIP, ELISA | Observed Molecular Weight: 199 aa, 22 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC002616 |
| Conjugate: Unconjugated | Gene Symbol: Transgelin-2/TAGLN2 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 8407 |
| Application: Western Blot (WB) | RRID: AB_2271433 |
| Dilution: WB : 1:500-1:2000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse | Form: Liquid |
| Host / Isotype: Mouse / IgG1 | Background Information: The transgelin family is a group of proteins that belong to 22 kDa actin-related corpnin superfamily. Of all three isoforms, transgelin 1 is the best characterized. Transgelin 1, also known as SM22 alpha, is a specific marker for differentiated smooth muscle cells. Transgelin 2, also known as SM22 beta, is expressed by both smooth muscle and non-smooth muscle cells in a temporally and spatially regulated pattern. Trangenlin 3, also known as NP25, is only found in highly differentiated neuronal cells. Our test result showed that this antibody Is specific to TAGLN2. It does not bind TAGLN1 and TAGLN3. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
