FTO Monoclonal antibody proteintech 68111-1-Ig
$449.00
In stock
SKU
68111-1-Ig
1E8B1, KIAA1752
| Host / Isotype: Mouse / IgG2b | Class: Monoclonal |
| Reactivity: Human, Mouse, Pig And More (1) | Immunogen: CatNo: Ag26095 Product name: Recombinant human FTO protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 400-505 aa of NM_001080432 Sequence: MAQLEALWKKMEGVTNAVLHEVKREGLPVEQRNEILTAILASLTARQNLRREWHARCQSRIARTLPADQKPECRPYWEKDDASMPLPFDLTDIVSELRGQLLEAKP Predict reactive species |
| Applications: WB, IHC, FC (Intra), RIP, ELISA | Observed Molecular Weight: 58 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: NM_001080432 |
| Conjugate: Unconjugated | Gene Symbol: FTO |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 79068 |
| Application: Western Blot (WB) | RRID: AB_2923640 |
| Dilution: WB : 1:5000-1:10000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Pig | Form: Liquid |
| Host / Isotype: Mouse / IgG2b | Background Information: Fat mass and obesity-associated protein (FTO) has efficient oxidative demethylation activity targeting the abundant N6-methyladenosine (m6A) residues in RNA in vitro. Variants in the FTO (fat mass and obesity associated) gene are associated with increased body mass index in humans. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
