EPO/Erythropoietin Monoclonal antibody proteintech 66975-1-Ig
$449.00
In stock
SKU
66975-1-Ig
EPO, MVCD2, erythropoietin, Epoetin, EP
| Host / Isotype: Mouse / IgG2a | Class: Monoclonal |
| Reactivity: Human And More (2) | Immunogen: CatNo: Ag23054 Product name: Recombinant human EPO protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 29-193 aa of BC093628 Sequence: PPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR Predict reactive species |
| Applications: WB, IHC, IF/ICC, ELISA | Observed Molecular Weight: 193 aa, 21 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: EPO/Erythropoietin |
| Conjugate: Unconjugated | Gene Symbol: 2056 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): AB_2882295 |
| Application: Western Blot (WB) | RRID: Unconjugated |
| Dilution: WB : 1:5000-1:50000 | Conjugate: Liquid |
| Tested Reactivity: Human | Form: Protein A purification |
| Host / Isotype: Mouse / IgG2a | Background Information: Erythropoietin (Epo) is a member of the EPO/TPO family and encodes a secreted, glycosylated cytokine composed of four alpha helical bundles. The protein is found in the plasma and regulates red cell production by promoting erythroid differentiation and initiating hemoglobin synthesis. Its effect is realized by binding erythropoietin receptor (EpoR) expressed on erythroid progenitor cells. EpoR, is a glycoprotein expressed on megakaryocytes, erythroid progenitors and endothelial cells. Epo also has neuroprotective activity against a variety of potential brain injuries and antiapoptotic functions in several tissue types. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
