IL-17A Polyclonal antibody proteintech 13082-1-AP
$449.00
In stock
SKU
13082-1-AP
CTLA 8, CTLA8, IL 17, IL 17A, IL17, IL-17, IL17A, interleukin 17A
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human And More (1) | Immunogen: CatNo: Ag3733 Product name: Recombinant human IL-17A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-155 aa of BC067505 Sequence: MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA Predict reactive species |
| Applications: WB, IHC, IF, ELISA | Observed Molecular Weight: 155 aa, 18 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: IL-17A |
| Conjugate: Unconjugated | Gene Symbol: 3605 |
| Tested Applications: Positive IHC detected in | Gene ID (NCBI): ENSG00000112115 |
| Application: Immunohistochemistry (IHC) | RRID: AB_10644322 |
| Dilution: IHC : 1:50-1:500 | Conjugate: Unconjugated |
| Tested Reactivity: Human | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: IL17A, also named as IL-17, is a proinflammatory cytokine. IL-17, synthesized only by memory T cells and natural killer cells, has pleiotropic effects, mainly in the recruitment and activation of neutrophils. This cytokine regulates the activities of NF-kappaB and mitogen-activated protein kinases. This cytokine can stimulate the expression of IL6 and cyclooxygenase-2 (PTGS2/COX-2), as well as enhance the production of nitric oxide (NO). High levels of this cytokine are associated with several chronic inflammatory diseases including rheumatoid arthritis, psoriasis and multiple sclerosis. The IL-17 receptor is a type I transmembrane protein, that is widely expressed on epithelial cells, fibroblasts, B and T cells, and monocytic cells. In psoriatic skin lesions, both Th17 cells and their downstream effector molecules, e.g. IL-17 and IL-22, are highly increased. This antibody got 32-35 kDa band in western blot, maybe due to homodimer formation and differential glycosylations. |