C9orf72 Monoclonal antibody proteintech 66140-1-Ig
$449.00
In stock
SKU
66140-1-Ig
Guanine nucleotide exchange factor C9orf72, DENNL72, DENND9, C9RANT, 3D2H6
| Host / Isotype: Mouse / IgG2a | Class: Monoclonal |
| Reactivity: human, mouse, rat | Immunogen: CatNo: Ag21080 Product name: Recombinant human C9orf72 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 1-169 aa of BC020851 Sequence: MSTLCPPPSPAVAKTEIALSGKSPLLAATFAYWDNILGPRVRHIWAPKTEQVLLSDGEITFLANHTLNGEILRNAESGAIDVKFFVLSEKGVIIVSLIFDGNWNGDRSTYGLSIILPQTELSFYLPLHRVCVDRLTHIIRKGRIWMHKERQENVQKIILEGTERMEDQG Predict reactive species |
| Applications: WB, IHC, IF/ICC, IP, ELISA | Observed Molecular Weight: 481 aa, 54 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC020851 |
| Conjugate: Unconjugated | Gene Symbol: C9orf72 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 203228 |
| Application: Western Blot (WB) | RRID: AB_2784547 |
| Dilution: WB : 1:500-1:1000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Mouse / IgG2a | Background Information: C9ORF72 has a domain whith polymorphic hexanucleotide repeat (GGGGCC). The C9ORF72-hexanucleotide repeat expansions have been recently identified as genetic markers in amyotrophic lateral sclerosis (ALS) and frontotemporal lobar degeneration (FTLD). FTLD-TDP has five subtypes: Sporadic FTLD, GRN mutation FTLD, TARDBP mutation FTLD, VCP mutation FTLD and C9ORF72 mutation FTLD. The C9ORF72 repeat expansions may indicate a worse prognosis in ALS. Human C9ORF72 has some isoforms with MW 54-60 kDa and 25-30 kDa. Mouse C9orf72 has some isoforms with MW 50-60 kDa and 35 kDa. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
