IBA1 Polyclonal antibody proteintech 10904-1-AP
$449.00
In stock
SKU
10904-1-AP
AIF1, AIF 1, AIF-1, allograft inflammatory factor 1, G1
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human, Mouse, Rat And More (5) | Immunogen: CatNo: Ag1363 Product name: Recombinant human IBA1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-147 aa of BC009474 Sequence: MSQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEKPTGPPAKKAISELP Predict reactive species |
| Applications: IHC, IF-P, FC (Intra), IP, ELISA | Observed Molecular Weight: 17 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: IBA1 |
| Conjugate: Unconjugated | Gene Symbol: 199 |
| Tested Applications: Positive IP detected in | Gene ID (NCBI): ENSG00000204472 |
| Application: Immunoprecipitation (IP) | RRID: AB_2224377 |
| Dilution: IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Rabbit / IgG |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
