BNIP3L Monoclonal antibody proteintech 68118-1-Ig
$449.00
In stock
SKU
68118-1-Ig
1F6A3, Adenovirus E1B19K-binding protein B5, BCL2/adenovirus E1B 19 kDa protein-interacting protein 3A, BNIP3A, BNIP3H
| Host / Isotype: Mouse / IgG1 | Class: Monoclonal |
| Reactivity: Human, Rat And More (2) | Immunogen: CatNo: Ag31547 Product name: Recombinant human BNIP3L protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 77-146 aa of BC001559 Sequence: DAQHESGQSSSRGSSHCDSPSPQEDGQIMFDVEMHTSRDHSSQSEEEVVEGEKEVEALKKSADWVSDWSS Predict reactive species |
| Applications: WB, IHC, IF, IP, ELISA | Observed Molecular Weight: 24 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC001559 |
| Conjugate: Unconjugated | Gene Symbol: BNIP3L |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 665 |
| Application: Western Blot (WB) | RRID: AB_2923647 |
| Dilution: WB : 1:5000-1:50000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Rat | Form: Liquid |
| Host / Isotype: Mouse / IgG1 | Background Information: BNIP3L/Nix is a mitochondrial protein from the outer membrane that belongs to the BH3-only protein from the BCL2 family. BNIP3L was initially recognized as a proapoptotic protein with milder efficacy in inducing apoptosis compared to other proteins in this family. These phenotypes raised concerns about the molecular function of BNIP3L besides inducing apoptosis. Moreover, studies have shown that BNIP3L is a 24-kDa protein, which is predominantly expressed as a 48-kDa dimer. When analyzed by SDS-PAGE, BNIP3 migrates predominantly as a about 60 kDa dimer in addition to the 30 kDa monomer. (PMID: 34930907, PMID: 32286918) |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
