NHE1 Monoclonal antibody proteintech 67363-1-Ig
$449.00
In stock
SKU
67363-1-Ig
SLC9A1, 3D9F3, APNH, APNH1, FLJ42224
| Host / Isotype: Mouse / IgG1 | Class: Monoclonal |
| Reactivity: human, rat | Immunogen: CatNo: Ag14329 Product name: Recombinant human NHE1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-108 aa of BC012121 Sequence: MVLRSGICGLSPHRIFPSLLVVVALVGLLPVLRSHGLQLSPTASTIRSSEPPRERSIGDVTTAPPEVTPESRPVNHSVTDHGMKPRKAFPVLGIDYTHVRTPFEISLW Predict reactive species |
| Applications: WB, IHC, ELISA | Observed Molecular Weight: 815 aa, 91 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC012121 |
| Conjugate: Unconjugated | Gene Symbol: NHE1 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 6548 |
| Application: Western Blot (WB) | RRID: AB_2882615 |
| Dilution: WB : 1:5000-1:50000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Rat | Form: Liquid |
| Host / Isotype: Mouse / IgG1 | Background Information: NHE1, also named as SLC9A1, is involved in pH regulation that can eliminate acids generated by active metabolism and counter adverse environmental conditions. NHE1 plays an important role in signal transduction. It has been shown that NHE1 participates in the development and progression of human breast cancer, gastric cancer and others. NHE1 has some isoforms with 91 kDa , 110 kDa (phosphoglycoprotein) and 210 kDa (dimeric protein). (PMID:28098891, 27751915, 8300588) |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
