CD47 Polyclonal antibody proteintech 20305-1-AP
$449.00
In stock
SKU
20305-1-AP
MER6, Leukocyte surface antigen CD47, Integrin-associated protein, Integrin associated protein, IAP
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human And More (2) | Immunogen: CatNo: Ag14132 Product name: Recombinant human CD47 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-150 aa of BC010016 Sequence: MWPLVAALLLGSACCGSAQLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSPNENILIVIFPI Predict reactive species |
| Applications: WB, IHC, IF, ELISA | Observed Molecular Weight: 323 aa, 35 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: CD47 |
| Conjugate: Unconjugated | Gene Symbol: 961 |
| Tested Applications: Positive IHC detected in | Gene ID (NCBI): AB_10732838 |
| Application: Immunohistochemistry (IHC) | RRID: Unconjugated |
| Dilution: IHC : 1:500-1:2000 | Conjugate: Liquid |
| Tested Reactivity: Human | Form: Antigen affinity purification |
| Host / Isotype: Rabbit / IgG | Background Information: CD47, also known as integrin-associated protein (IAP), is a member of the immunoglobulin superfamily containing a five-pass transmembrane attachment. CD47 is heavily glycosylated and widely expressed by hematopoietic and nonhematopoietic cells. CD47 interacts with several membrane integrins and also acts as a receptor for thrombospondin (THBS1). It is involved in a range of cellular processes, including apoptosis, proliferation, adhesion, and migration. CD47 also functions as a ligand for signal regulatory protein-α (SIRPα). Upon binding CD47, SIRPα initiates a signaling cascade that results in the inhibition of phagocytosis. |
Reviews
Write Your Own Review