MYD88 Polyclonal antibody proteintech 23230-1-AP
$449.00
In stock
SKU
23230-1-AP
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human And More (7) | Immunogen: CatNo: Ag19770 Product name: Recombinant human MYD88 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-150 aa of BC013589 Sequence: MAAGGPGAGSAAPVSSTSSLPLAALNMRVRRRLSLFLNVRTQVAADWTALAEEMDFEYLEIRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGPSIEEDCQKYILKQQQEEAEKPLQVAAVDSSVPRTAELAGITTL Predict reactive species |
| Applications: WB, IHC, IF, IP, CoIP, ELISA | Observed Molecular Weight: 33 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC013589 |
| Conjugate: Unconjugated | Gene Symbol: MYD88 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 4615 |
| Application: Western Blot (WB) | RRID: AB_2879236 |
| Dilution: WB : 1:5000-1:50000 | Conjugate: Unconjugated |
| Tested Reactivity: Human | Form: Liquid |
| Host / Isotype: Rabbit / IgG |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
