IL-1 beta Polyclonal antibody proteintech 26048-1-AP
$449.00
In stock
SKU
26048-1-AP
IL 1beta, Il1b, IL 1 beta, Il 1b, IL-1 beta,IL 1 beta,IL1beta
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human, Mouse, Rat And More (3) | Immunogen: CatNo: Ag23461 Product name: Recombinant mouse IL-1B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 118-269 aa of NM_008361 Sequence: VPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS Predict reactive species |
| Applications: WB, IHC, IF/ICC, ELISA | Observed Molecular Weight: 31 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: NM_008361 |
| Conjugate: Unconjugated | Gene Symbol: IL-1 beta |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 16176 |
| Application: Western Blot (WB) | RRID: AB_2880351 |
| Dilution: WB : 1:1000-1:6000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: Interleukin-1, produced mainly by blood monocytes, mediates the panoply of host reactions collectively known as acute phase response. It is identical to endogenous pyrogen. The multiple biologic activities that define IL1 are properties of a 15- to 18-kD protein that is derived from a 30- to 35-kD precursor. Interleukin 1β (IL-1B) is a member of the interleukin 1 cytokine family. It is a pro-inflammatory cytokine against infection, playing an important role in the pathogenesis of cancers. It signals through various adaptor proteins and kinases that lead to activation of numerous downstream targets. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
