SLC31A1 Monoclonal antibody proteintech 67221-1-Ig
$449.00
In stock
SKU
67221-1-Ig
COPT1, 1A4H5, CTR1, Truncated CTR1 form
| Host / Isotype: Mouse / IgG2b | Class: Monoclonal |
| Reactivity: Human And More (1) | Immunogen: CatNo: Ag28410 Product name: Recombinant human SLC31A1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-67 aa of BC013611 Sequence: MDHSHHMGMSYMDSNSTMQPSHHHPTTSASHSHGGGDSSMMMMPMTFYFGFKNVELLFSGLVINTAG Predict reactive species |
| Applications: WB, IHC, IF-P, ELISA | Observed Molecular Weight: 21 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC013611 |
| Conjugate: Unconjugated | Gene Symbol: SLC31A1 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 1317 |
| Application: Western Blot (WB) | RRID: AB_2882512 |
| Dilution: WB : 1:5000-1:20000 | Conjugate: Unconjugated |
| Tested Reactivity: Human | Form: Liquid |
| Host / Isotype: Mouse / IgG2b |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
