GSK3B Monoclonal antibody proteintech 67329-1-Ig
$449.00
In stock
SKU
67329-1-Ig
GSK3 beta, GSK-3 beta, GSK 3 beta, EC:2.7.11.26, EC:2.7.11.1
| Host / Isotype: Mouse / IgG1 | Class: Monoclonal |
| Reactivity: Human, Pig And More (2) | Immunogen: CatNo: Ag17320 Product name: Recombinant human GSK3B protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 355-433 aa of BC000251 Sequence: ELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQTNNAASASASNST Predict reactive species |
| Applications: WB, IHC, IF/ICC, CoIP, ELISA | Observed Molecular Weight: 433 aa, 48 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC000251 |
| Conjugate: Unconjugated | Gene Symbol: GSK3B |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 2932 |
| Application: Western Blot (WB) | RRID: AB_2882588 |
| Dilution: WB : 1:5000-1:50000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Pig | Form: Liquid |
| Host / Isotype: Mouse / IgG1 | Background Information: Glycogen synthase kinase-3 (GSK3) is a proline-directed serine-threonine kinase that was initially identified as a phosphorylating and inactivating glycogen synthase .GSK3B is involved in energy metabolism, neuronal cell development, and body pattern formation.In skeletal muscle, it contributes to insulin regulation of glycogen synthesis by phosphorylating and inhibiting GYS1 activity and hence glycogen synthesis. Researches showed that the crystal structure of human GSK3B, expressed in insect cells, at 2.8-angstrom resolution . |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
