C-Reactive Protein/CRP Monoclonal antibody proteintech 66250-1-Ig
$449.00
In stock
SKU
66250-1-Ig
CRP, PTX1, C-reactive protein(1-205), C-Reactive Protein, C reactive protein
| Host / Isotype: Mouse / IgG2a | Class: Monoclonal |
| Reactivity: Human, Mouse, Rat, Pig And More (1) | Immunogen: CatNo: Ag9883 Product name: Recombinant human CRP protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-91 aa of BC020766 Sequence: MEKLLCFLVLTSLSHAFGQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKAFTVCLHFYTELSSTRGPNVLNWRALKYEVQGEVFTKPQLWP Predict reactive species |
| Applications: WB, IHC, IF-P, ELISA | Observed Molecular Weight: 224 aa, 25 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC020766 |
| Conjugate: Unconjugated | Gene Symbol: CRP |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 1401 |
| Application: Western Blot (WB) | RRID: AB_2881638 |
| Dilution: WB : 1:2000-1:10000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat, Pig | Form: Liquid |
| Host / Isotype: Mouse / IgG2a | Background Information: C-reactive protein (CRP) is an acute-phase serum protein synthesized by the liver in response to interleukin-6 (IL-6) during inflammation. The name of CRP derives from its ability to react with the C polysaccharide of Streptococcus pneumoniae. CRP is an annular, pentameric protein that belongs to the pentraxin family of proteins. CRP displays several functions associated with host defense: it promotes agglutination, bacterial capsular swelling, phagocytosis and complement fixation through its calcium-dependent binding to phosphorylcholine. It is used mainly as a marker of inflammation. |
Reviews
Write Your Own Review