S100A4 Monoclonal antibody proteintech 66489-1-Ig
$449.00
In stock
SKU
66489-1-Ig
2G11B4, Calvasculin, CAPL, Fibroblast Specific Protein, Fibroblast-specific protein 1
| Host / Isotype: Mouse / IgG2a | Class: Monoclonal |
| Reactivity: Human, Mouse And More (1) | Immunogen: CatNo: Ag9019 Product name: Recombinant human S100A4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-101 aa of BC016300 Sequence: MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK Predict reactive species |
| Applications: WB, IHC, IF/ICC, ELISA | Observed Molecular Weight: 101 aa, 12 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC016300 |
| Conjugate: Unconjugated | Gene Symbol: S100A4 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 6275 |
| Application: Western Blot (WB) | RRID: ENSG00000196154 |
| Dilution: WB : 1:5000-1:50000 | Conjugate: AB_2881854 |
| Tested Reactivity: Human, Mouse | Form: Unconjugated |
| Host / Isotype: Mouse / IgG2a | Background Information: S100A4 is a member of the S100 family of calcium-binding proteins. The S100 family members have been involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100A4 is known to localize to and function in the nucleus, cytoplasm of cells, and the extracellular space. S100A4 has also been shown to be associated with tumor growth, motility, invasion, metastasis, angiogenesis, apoptosis, and chemoresistance. It is a fibroblast-specific protein associated with mesenchymal cell morphology and motility, is expressed during epithelial-mesenchymal transformations (EMT) in vivo (PMID: 9362334). It is a specific prognostic marker for renal survival in patients with IgAN (PMID: 16105038). It is also an improved marker for lung fibroblasts that could be useful for investigating the pathogenesis of pulmonary fibrosis(PMID: 15618458). Overexpression of S100A4 is correlated with a worse prognosis inpatients with various types of cancer. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
