Perilipin 5 Polyclonal antibody proteintech 26951-1-AP
$449.00
In stock
SKU
26951-1-AP
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human, Mouse, Rat, Pig And More (1) | Immunogen: CatNo: Ag25272 Product name: Recombinant human LSDP5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 381-463 aa of BC131524 Sequence: ILVERPEPLPDLADLVDEVIGGPDPRWAHLDWPAQQRAWEAEHRDGSGNGDGDRMGVAGDICEQEPETPSCPVKHTLMPELDF Predict reactive species |
| Applications: WB, IHC, IF, IP, ELISA | Observed Molecular Weight: 463 aa, 51 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC131524 |
| Conjugate: Unconjugated | Gene Symbol: Perilipin 5 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 440503 |
| Application: Western Blot (WB) | RRID: AB_2880699 |
| Dilution: WB : 1:2000-1:10000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat, Pig | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: Perilipin 5 (also known as LSDP5/OXPAT) is a lipid droplet (LD) coat protein that promotes association of LDs with mitochondria and is mainly present in tissues with a high fat-oxidative capacity, such as heart, skeletal muscles and brown adipose tissue. It plays an important role in the regulation of cardiac lipid storage and function. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
