JUN Monoclonal antibody proteintech 66313-1-Ig
$449.00
In stock
SKU
66313-1-Ig
AP 1, AP1, 1G6B11, Activator protein 1, c Jun
| Host / Isotype: Mouse / IgG1 | Class: Monoclonal |
| Reactivity: human, mouse, rat | Immunogen: CatNo: Ag17639 Product name: Recombinant human JUN protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 92-227 aa of BC068522 Sequence: PTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKE Predict reactive species |
| Applications: WB, ELISA | Observed Molecular Weight: 331 aa, 36 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC068522 |
| Conjugate: Unconjugated | Gene Symbol: JUN |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 3725 |
| Application: Western Blot (WB) | RRID: AB_2881694 |
| Dilution: WB : 1:5000-1:50000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Mouse / IgG1 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
