ASC/TMS1 Monoclonal antibody proteintech 67494-1-Ig
$449.00
In stock
SKU
67494-1-Ig
PYCARD, 2G12E6, Apoptosis-associated speck-like protein containing a CARD, ASC, CARD5
| Host / Isotype: Mouse / IgG1 | Class: Monoclonal |
| Reactivity: human | Immunogen: CatNo: Ag28424 Product name: Recombinant human TMS1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-135 aa of BC004470 Sequence: MGRARDAILDALENLTAEELKKFKLQAATHQGSGAAPAGIQAPPQSAAKPGLHFIDQHRAALIARVTNVEWLLDALYGKVLTDEQYQAVRAEPTNPSKMRKLFSFTPAWNWTCKDLLLQALRESQSYLVEDLERS Predict reactive species |
| Applications: WB, IHC, IF/ICC, IP, CoIP, ELISA | Observed Molecular Weight: 25 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC004470 |
| Conjugate: Unconjugated | Gene Symbol: ASC/TMS1 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 29108 |
| Application: Western Blot (WB) | RRID: AB_2882718 |
| Dilution: WB : 1:5000-1:50000 | Conjugate: Unconjugated |
| Tested Reactivity: Human | Form: Liquid |
| Host / Isotype: Mouse / IgG1 | Background Information: PYCARD , also known as ASC or TMS1, is a 195 amino acid protein containing an N-terminal Pyrin-like domain (PYD) and an 87 residue C-terminal Caspase-associated recruitment domain (CARD). It promotes caspase-mediated apoptosis which is mediated predominantly through the activation of caspase-9. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
